2.17 Rating by CuteStat

osei.us is 1 decade 1 year old. It is a domain having us extension. It has a global traffic rank of #23355264 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, osei.us is SAFE to browse.

PageSpeed Score
70
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 21
Daily Pageviews: 42

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 23,355,264
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

97.74.144.127

Hosted Country:

United States of America US

Location Latitude:

33.6119

Location Longitude:

-111.8906
OSEI | Oil Spill Eater International, Corp

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 13
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 97.74.144.127)

Creekside of Brentwood - Index

- creeksideofbrentwood.org

Creekside of Brentwood - Index

548,824 $ 1,200.00

راه کارگر نیوز

- rahekaregarnews.com

rahekaregar, راه کارگر,culture, rahekargar, iran, , politics, politic, left, socialism, ایران , news, persian, politics, news, revolution, reform, country, Teheran, Tabriz, Karaj, mashahd, abadan, kurdistan, kurdestan, rasht, ardebil, sanandaj, baneh, rahe karegar

1,387,314 $ 480.00

My Website | Just another WordPress site

- poolcleaningservicerepairmckinney.com
Not Applicable $ 8.95

Pool Cleaning and Repair Frisco Texas | Pool Cleaning Service and Repa

- poolcleaningservicerepairfrisco.com
Not Applicable $ 8.95

F.C. Playa Vista

- fcplayavista.com

FC Playa Vista is a recrational soccer club located in Marina Del Rey, California near Playa Vista. We have just begun expanding the club and will build several teams to play throughout Los Angeles.

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Mon, 12 Jan 2015 00:46:06 GMT
Server: Apache
X-Pingback: http://osei.us/xmlrpc.php
Link: <http://osei.us/>; rel=shortlink
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: Camelot 25, LLC
Registration Date: Dec 17, 2012, 12:00 AM 1 decade 1 year 4 months ago
Last Modified: Dec 25, 2013, 12:00 AM 1 decade 4 months 1 week ago
Expiration Date: Dec 17, 2017, 12:00 AM 6 years 4 months 2 weeks ago
Domain Status:
CLIENT TRANSFER PROHIBITED
Owner's E-Mail: brushedupbowls@gmail.com

DNS Record Analysis

Host Type TTL Extra
osei.us A 596 IP: 97.74.144.127
osei.us NS 3599 Target: ns04.domaincontrol.com
osei.us NS 3599 Target: ns03.domaincontrol.com
osei.us SOA 3599 MNAME: ns03.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2014020900
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 86400
osei.us MX 3599 Target: smtp.secureserver.net
osei.us MX 3599 Priority: 10
Target: mailstore1.secureserver.net

Similarly Ranked Websites

103newstreet.com

- 103newstreet.com
23,355,271 $ 8.95

My Jewelry Chest – Buy Awesome Jewelry Online

- myjewelrychest.com
23,355,340 $ 8.95

rss-image.com

- rss-image.com
23,355,348 $ 8.95

PacificTravel38 | Tour Du Lich Thai Land

- pacifictravel38.com
23,355,355 $ 8.95